PDB entry 1t98

View 1t98 on RCSB PDB site
Description: Crystal Structure of MukF(1-287)
Class: cell cycle
Keywords: winged helix, helix-turn helix, domain swapped, condensin, cell cycle
Deposited on 2004-05-14, released 2005-05-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.235
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromosome partition protein mukF
    Species: Escherichia coli [TaxId:562]
    Gene: MUKF, KICB, B0922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60293
      • modified residue (46)
      • modified residue (80)
      • modified residue (126)
      • modified residue (177)
      • modified residue (240)
    Domains in SCOPe 2.05: d1t98a1, d1t98a2
  • Chain 'B':
    Compound: Chromosome partition protein mukF
    Species: Escherichia coli [TaxId:562]
    Gene: MUKF, KICB, B0922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60293
      • modified residue (46)
      • modified residue (80)
      • modified residue (126)
      • modified residue (177)
    Domains in SCOPe 2.05: d1t98b1, d1t98b2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t98A (A:)
    msefsqtvpelvawarkndfsislpvdrlsfllavatlngerldgemsegelvdafrhvs
    dafeqtsetigvrannaindmvrqrllnrftseqaegnaiyrltplgigitdyyirqref
    stlrlsmqlsivagelkraadaaeeggdefhwhrnvyaplkysvaeifdsidltqrlmde
    qqqqvkddiaqllnkdwraaisscelllsetsgtlrelqdtleaagdklqanllriqdat
    mthddlhfvdrlvfdlqskldriiswgqqsidlwigydrhvhkfirt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t98A (A:)
    vpelvawarkndfsislpvdrlsfllavatlngerldgemsegelvdafrhvsdafeqts
    etigvrannaindmvrqrllnrftiyrltplgigitdyyirqrefstlrlsmqlsivage
    lkraadaaeeggdefhwhrnvyaplkysvaeifdsidltqrlmdeqqqqvkddiaqllnk
    dwraaisscelllsetsgtlrelqdtleaagdklqanllriqdatmthddlhfvdrlvfd
    lqskldriiswgqqsidlwigydrhv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t98B (B:)
    msefsqtvpelvawarkndfsislpvdrlsfllavatlngerldgemsegelvdafrhvs
    dafeqtsetigvrannaindmvrqrllnrftseqaegnaiyrltplgigitdyyirqref
    stlrlsmqlsivagelkraadaaeeggdefhwhrnvyaplkysvaeifdsidltqrlmde
    qqqqvkddiaqllnkdwraaisscelllsetsgtlrelqdtleaagdklqanllriqdat
    mthddlhfvdrlvfdlqskldriiswgqqsidlwigydrhvhkfirt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t98B (B:)
    sqtvpelvawarkndfsislpvdrlsfllavatlngerldgemsegelvdafrhvsdafe
    qtsetigvrannaindmvrqrllnrftiyrltplgigitdyyirqrefstlrlsmqlsiv
    agelkraadaaeeggdefhwhrnvyaplkysvaeifdsidltqrlmdeqqqqvkddiaql
    lnisscelllsetsgtlrelqdtleaagdklqanllriqdahddlhfvdrlvfdlqskld
    riiswgqqsidlwigydrhv