PDB entry 1t95

View 1t95 on RCSB PDB site
Description: Crystal Structure of the Shwachman-Bodian-Diamond Syndrome Protein Orthologue from Archaeoglobus fulgidus
Class: unknown function
Keywords: Shwachman-Bodian-Diamond Syndrome Protein Orthologue, UNKNOWN FUNCTION
Deposited on 2004-05-14, released 2004-06-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.214
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein AF0491
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF0491
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29759 (Start-239)
      • modified residue (100)
      • modified residue (169)
      • modified residue (208)
      • modified residue (214)
      • modified residue (219)
    Domains in SCOPe 2.03: d1t95a1, d1t95a2, d1t95a3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t95A (A:)
    mhhhhhhvsldkaviarlrkggeefevlvdpylardlkegkevnfedllaaeevfkdakk
    gerasvdelrkifgtddvfeiarkiilegevqitaeqrremleakrkqiinfisrntidp
    rtnaphppsrieraleeakvhidifksveaqvkdivkalkpilplkfeemeiaikippeh
    tgraisalynfggvtreewqrdgswicvmripsgmygdlmdllgkvakgealtkvlrrig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t95A (A:)
    dkaviarlrkggeefevlvdpylardlkegkevnfedllaaeevfkdakkgerasvdelr
    kifgtddvfeiarkiilegevqitaeqrremleakrkqiinfisrntidprtnaphppsr
    ieraleeakvhidifksveaqvkdivkalkpilplkfeemeiaikippehtgraisalyn
    fggvtreewqrdgswicvmripsgmygdlmdllgkvakgealtkvlrrig