PDB entry 1t90

View 1t90 on RCSB PDB site
Description: Crystal structure of methylmalonate semialdehyde dehydrogenase from Bacillus subtilis
Class: oxidoreductase
Keywords: oxidoreductase, NAD
Deposited on 2004-05-14, released 2006-01-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable methylmalonate-semialdehyde dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: MMSA, IOLA, E83A, BSU39760
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t90a_
  • Chain 'B':
    Compound: Probable methylmalonate-semialdehyde dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: MMSA, IOLA, E83A, BSU39760
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t90b_
  • Chain 'C':
    Compound: Probable methylmalonate-semialdehyde dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: MMSA, IOLA, E83A, BSU39760
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t90c_
  • Chain 'D':
    Compound: Probable methylmalonate-semialdehyde dehydrogenase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: MMSA, IOLA, E83A, BSU39760
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t90d_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t90A (A:)
    aeirklknyingewvesktdqyedvvnpatkevlcqvpistkedidyaaqtaaeafktws
    kvavprrarilfnfqqllsqhkeelahlitiengkntkealgevgrgienvefaagapsl
    mmgdslasiatdveaanyrypigvvggiapfnfpmmvpcwmfpmaialgntfilkpsert
    pllteklvelfekaglpkgvfnvvygahdvvngilehpeikaisfvgskpvgeyvykkgs
    enlkrvqsltgaknhtivlndanledtvtnivgaafgsagercmacavvtveegiadefm
    aklqekvadikignglddgvflgpvirednkkrtlsyiekgleegarlvcdgrenvsddg
    yfvgptifdnvttemtiwkdeifapvlsvirvknlkeaieianksefangaclftsnsna
    iryfrenidagmlginlgvpapmaffpfsgwkssffgtlhangkdsvdfytrkkvvtary
    papdfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t90A (A:)
    eirklknyingewvesktdqyedvvnpatkevlcqvpistkedidyaaqtaaeafktwsk
    vavprrarilfnfqqllsqhkeelahlitiengkntkealgevgrgienvefaagapslm
    mgdslasiatdveaanyrypigvvggiapfnfpmmvpcwmfpmaialgntfilkpsertp
    llteklvelfekaglpkgvfnvvygahdvvngilehpeikaisfvgskpvgeyvykkgse
    nlkrvqsltgaknhtivlndanledtvtnivgaafgsagercmacavvtveegiadefma
    klqekvadikignglddgvflgpvirednkkrtlsyiekgleegarlvcdgrenvsddgy
    fvgptifdnvttemtiwkdeifapvlsvirvknlkeaieianksefangaclftsnsnai
    ryfrenidagmlginlgvpapmaffpfsgwkssffgtlhangkdsvdfytrkkvvtaryp
    apdf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t90B (B:)
    aeirklknyingewvesktdqyedvvnpatkevlcqvpistkedidyaaqtaaeafktws
    kvavprrarilfnfqqllsqhkeelahlitiengkntkealgevgrgienvefaagapsl
    mmgdslasiatdveaanyrypigvvggiapfnfpmmvpcwmfpmaialgntfilkpsert
    pllteklvelfekaglpkgvfnvvygahdvvngilehpeikaisfvgskpvgeyvykkgs
    enlkrvqsltgaknhtivlndanledtvtnivgaafgsagercmacavvtveegiadefm
    aklqekvadikignglddgvflgpvirednkkrtlsyiekgleegarlvcdgrenvsddg
    yfvgptifdnvttemtiwkdeifapvlsvirvknlkeaieianksefangaclftsnsna
    iryfrenidagmlginlgvpapmaffpfsgwkssffgtlhangkdsvdfytrkkvvtary
    papdfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t90B (B:)
    eirklknyingewvesktdqyedvvnpatkevlcqvpistkedidyaaqtaaeafktwsk
    vavprrarilfnfqqllsqhkeelahlitiengkntkealgevgrgienvefaagapslm
    mgdslasiatdveaanyrypigvvggiapfnfpmmvpcwmfpmaialgntfilkpsertp
    llteklvelfekaglpkgvfnvvygahdvvngilehpeikaisfvgskpvgeyvykkgse
    nlkrvqsltgaknhtivlndanledtvtnivgaafgsagercmacavvtveegiadefma
    klqekvadikignglddgvflgpvirednkkrtlsyiekgleegarlvcdgrenvsddgy
    fvgptifdnvttemtiwkdeifapvlsvirvknlkeaieianksefangaclftsnsnai
    ryfrenidagmlginlgvpapmaffpfsgwkssffgtlhangkdsvdfytrkkvvtaryp
    apdf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t90C (C:)
    aeirklknyingewvesktdqyedvvnpatkevlcqvpistkedidyaaqtaaeafktws
    kvavprrarilfnfqqllsqhkeelahlitiengkntkealgevgrgienvefaagapsl
    mmgdslasiatdveaanyrypigvvggiapfnfpmmvpcwmfpmaialgntfilkpsert
    pllteklvelfekaglpkgvfnvvygahdvvngilehpeikaisfvgskpvgeyvykkgs
    enlkrvqsltgaknhtivlndanledtvtnivgaafgsagercmacavvtveegiadefm
    aklqekvadikignglddgvflgpvirednkkrtlsyiekgleegarlvcdgrenvsddg
    yfvgptifdnvttemtiwkdeifapvlsvirvknlkeaieianksefangaclftsnsna
    iryfrenidagmlginlgvpapmaffpfsgwkssffgtlhangkdsvdfytrkkvvtary
    papdfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t90C (C:)
    eirklknyingewvesktdqyedvvnpatkevlcqvpistkedidyaaqtaaeafktwsk
    vavprrarilfnfqqllsqhkeelahlitiengkntkealgevgrgienvefaagapslm
    mgdslasiatdveaanyrypigvvggiapfnfpmmvpcwmfpmaialgntfilkpsertp
    llteklvelfekaglpkgvfnvvygahdvvngilehpeikaisfvgskpvgeyvykkgse
    nlkrvqsltgaknhtivlndanledtvtnivgaafgsagercmacavvtveegiadefma
    klqekvadikignglddgvflgpvirednkkrtlsyiekgleegarlvcdgrenvsddgy
    fvgptifdnvttemtiwkdeifapvlsvirvknlkeaieianksefangaclftsnsnai
    ryfrenidagmlginlgvpapmaffpfsgwkssffgtlhangkdsvdfytrkkvvtaryp
    apdf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1t90D (D:)
    aeirklknyingewvesktdqyedvvnpatkevlcqvpistkedidyaaqtaaeafktws
    kvavprrarilfnfqqllsqhkeelahlitiengkntkealgevgrgienvefaagapsl
    mmgdslasiatdveaanyrypigvvggiapfnfpmmvpcwmfpmaialgntfilkpsert
    pllteklvelfekaglpkgvfnvvygahdvvngilehpeikaisfvgskpvgeyvykkgs
    enlkrvqsltgaknhtivlndanledtvtnivgaafgsagercmacavvtveegiadefm
    aklqekvadikignglddgvflgpvirednkkrtlsyiekgleegarlvcdgrenvsddg
    yfvgptifdnvttemtiwkdeifapvlsvirvknlkeaieianksefangaclftsnsna
    iryfrenidagmlginlgvpapmaffpfsgwkssffgtlhangkdsvdfytrkkvvtary
    papdfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t90D (D:)
    eirklknyingewvesktdqyedvvnpatkevlcqvpistkedidyaaqtaaeafktwsk
    vavprrarilfnfqqllsqhkeelahlitiengkntkealgevgrgienvefaagapslm
    mgdslasiatdveaanyrypigvvggiapfnfpmmvpcwmfpmaialgntfilkpsertp
    llteklvelfekaglpkgvfnvvygahdvvngilehpeikaisfvgskpvgeyvykkgse
    nlkrvqsltgaknhtivlndanledtvtnivgaafgsagercmacavvtveegiadefma
    klqekvadikignglddgvflgpvirednkkrtlsyiekgleegarlvcdgrenvsddgy
    fvgptifdnvttemtiwkdeifapvlsvirvknlkeaieianksefangaclftsnsnai
    ryfrenidagmlginlgvpapmaffpfsgwkssffgtlhangkdsvdfytrkkvvtaryp
    apdf