PDB entry 1t8e

View 1t8e on RCSB PDB site
Description: T7 DNA Polymerase Ternary Complex with dCTP at the Insertion Site.
Class: transferase/electron transport/DNA
Keywords: protein, DNA, transferase, transferase/electron transport/DNA COMPLEX
Deposited on 2004-05-12, released 2004-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: 0.22
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase
    Species: Enterobacteria phage T7 [TaxId:10760]
    Gene: 5, T7DNApolymerase
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t8ea1, d1t8ea2
  • Chain 'B':
    Compound: Thioredoxin 1
    Species: Escherichia coli [TaxId:562]
    Gene: trxa, tsnc, fipa, b3781, c4701, z5291,Thioredoxin
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t8eb_
  • Chain 'C':
    Compound: 5'-d(p*cp*gp*ap*ap*ap*ap*cp*gp*ap*cp*gp*gp*cp*cp*ap*gp*tp*gp*cp*cp*ap*(2dt))-3'
  • Chain 'D':
    Compound: 25-mer
  • Heterogens: MG, SO4, DCT, MES, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t8eA (A:)
    mivsdieanallesvtkfhcgviydystaeyvsyrpsdfgayldaleaevargglivfhn
    ghkydvpaltklaklqlnrefhlprencidtlvlsrlihsnlkdtdmgllrsgklpgale
    awgyrlgemkgeykddfkrmleeqgeeyvdgmewwnfneemmdynvqdvvvtkallekll
    sdkhyfppeidftdvgyttfwsesleavdiehraawllakqerngfpfdtkaieelyvel
    aarrsellrkltetfgswyqpkggtemfchprtgkplpkypriktpkvggifkkpknkaq
    regrepceldtreyvagapytpvehvvfnpssrdhiqkklqeagwvptkytdkgapvvdd
    evlegvrvddpekqaaidlikeylmiqkrigqsaegdkawlryvaedgkihgsvnpngav
    tgrathafpnlaqipgvrspygeqcraafgaehhldgitgkpwvqagidasglelrclah
    fmarfdngeyaheilngdihtknqiaaelptrdnaktfiygflygagdekigqivgagke
    rgkelkkkflentpaiaalresiqqtlvessqwvageqqvkwkrrwikgldgrkvhvrsp
    haalntllqsagalicklwiikteemlvekglkhgwdgdfaymawvhdeiqvgcrteeia
    qvvietaqeamrwvgdhwnfrclldtegkmgpnwaich
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t8eB (B:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t8eB (B:)
    dkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnid
    qnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.