PDB entry 1t8d

View 1t8d on RCSB PDB site
Description: Structure of the C-type lectin domain of CD23
Class: immune system
Keywords: c-type lectin, fcerII, fc receptor, IgE, immune system
Deposited on 2004-05-12, released 2005-07-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Low affinity immunoglobulin epsilon Fc receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: FCER2, IGEBF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1t8da1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1t8dA (A:)
sgfvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhas
htgswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwndafcdr
klgawvcdrlatctppasegsae