PDB entry 1t89

View 1t89 on RCSB PDB site
Description: crystal structure of a human type III fc gamma receptor in complex with an fc fragment of igg1 (hexagonal)
Class: immune system
Keywords: Fc gamma receptor, IgG1, CD16, FcgRIII, immunoglobulin
Deposited on 2004-05-11, released 2004-09-14
The last revision prior to the SCOP 1.73 freeze date was dated 2007-07-24, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.247
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: recombinant IgG1 heavy chain
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAG00909
    Domains in SCOP 1.73: d1t89a1, d1t89a2
  • Chain 'B':
    Compound: recombinant IgG1 heavy chain
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAG00909
    Domains in SCOP 1.73: d1t89b1, d1t89b2
  • Chain 'C':
    Compound: low affinity immunoglobulin gamma fc region receptor III-b
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1t89c1, d1t89c2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t89A (A:)
    htcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgve
    vhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqp
    repqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgs
    fflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t89A (A:)
    lggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpree
    qynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlpps
    reemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdk
    srwqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t89B (B:)
    htcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgve
    vhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqp
    repqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgs
    fflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t89B (B:)
    apellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktk
    preeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvyt
    lppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskl
    tvdksrwqqgnvfscsvmhealhnhytqkslsl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t89C (C:)
    rtedlpkavvflepqwysvlekdsvtlkcqgayspednstqwfhneslissqassyfida
    atvndsgeyrcqtnlstlsdpvqlevhigwlllqaprwvfkeedpihlrchswkntalhk
    vtylqngkdrkyfhhnsdfhipkatlkdsgsyfcrglvgsknvssetvnititqgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t89C (C:)
    lpkavvflepqwysvlekdsvtlkcqgayspednstqwfhneslissqassyfidaatvn
    dsgeyrcqtnlstlsdpvqlevhigwlllqaprwvfkeedpihlrchswkntalhkvtyl
    qngkdrkyfhhnsdfhipkatlkdsgsyfcrglvgsknvssetvnit