PDB entry 1t7z

View 1t7z on RCSB PDB site
Description: Zn-alpha-2-glycoprotein; baculo-ZAG no PEG, no glycerol
Class: lipid binding protein
Keywords: MHC class I homolog, LIPID BINDING PROTEIN
Deposited on 2004-05-11, released 2004-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc-alpha-2-glycoprotein
    Species: Homo sapiens [TaxId:9606]
    Gene: AZGP1, ZAG, ZNGP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25311
      • engineered (88)
      • engineered (91)
    Domains in SCOPe 2.07: d1t7za1, d1t7za2
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t7zA (A:)
    qenqdgrysltyiytglskhvedvpafqalgslndlqffrynskdrksqpmglwrqvegm
    edwkqdsqlqkaredifmetlkdiveyykdstgshvlqgrfgceiennrssgafwkyyyd
    gkdyiefnkeipawvpfdpaaqitkqkweaepvyvqrakayleeecpatlrkylkyskni
    ldrqdppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngng
    tyqswvvvavppqdtapyschvqhsslaqplvvpweas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t7zA (A:)
    dgrysltyiytglskhvedvpafqalgslndlqffrynskdrksqpmglwrqvegmedwk
    qdsqlqkaredifmetlkdiveyykdstgshvlqgrfgceiennrssgafwkyyydgkdy
    iefnkeipawvpfdpaaqitkqkweaepvyvqrakayleeecpatlrkylkysknildrq
    dppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyqs
    wvvvavppqdtapyschvqhsslaqplvvpwea