PDB entry 1t7p

View 1t7p on RCSB PDB site
Description: T7 DNA polymerase complexed to DNA primer/template,a nucleoside triphosphate, and its processivity factor thioredoxin
Class: transferase/DNA
Keywords: T7 DNA polymerase, DNA replication, nucleotidyl transferase, sequencing, thioredoxin, processivity factor, complex (hydrolase/electron transport/DNA), transferase/DNA complex
Deposited on 1997-09-24, released 1998-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.24
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (DNA polymerase)
    Species: Enterobacteria phage T7 [TaxId:10760]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t7pa1, d1t7pa2
  • Chain 'B':
    Compound: protein (thioredoxin)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t7pb_
  • Chain 'P':
    Compound: DNA (5'-d(p*gp*cp*cp*ap*gp*tp*gp*cp*cp*ap*2da)-3')
  • Chain 'T':
    Compound: DNA (5'-d(p*cp*cp*tp*tp*gp*gp*cp*ap*cp*tp*gp*gp*c)-3')
  • Heterogens: MG, DG3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t7pA (A:)
    mivsdieanallesvtkfhcgviydystaeyvsyrpsdfgayldaleaevargglivfhn
    ghkydvpaltklaklqlnrefhlprencidtlvlsrlihsnlkdtdmgllrsgklpgale
    awgyrlgemkgeykddfkrmleeqgeeyvdgmewwnfneemmdynvqdvvvtkallekll
    sdkhyfppeidftdvgyttfwsesleavdiehraawllakqerngfpfdtkaieelyvel
    aarrsellrkltetfgswyqpkggtemfchprtgkplpkypriktpkvggifkkpknkaq
    regrepceldtreyvagapytpvehvvfnpssrdhiqkklqeagwvptkytdkgapvvdd
    evlegvrvddpekqaaidlikeylmiqkrigqsaegdkawlryvaedgkihgsvnpngav
    tgrathafpnlaqipgvrspygeqcraafgaehhldgitgkpwvqagidasglelrclah
    fmarfdngeyaheilngdihtknqiaaelptrdnaktfiygflygagdekigqivgagke
    rgkelkkkflentpaiaalresiqqtlvessqwvageqqvkwkrrwikgldgrkvhvrsp
    haalntllqsagalicklwiikteemlvekglkhgwdgdfaymawvhdeiqvgcrteeia
    qvvietaqeamrwvgdhwnfrclldtegkmgpnwaich
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t7pA (A:)
    mivsdieanallesvtkfhcgviydystaeyvsyrpsdfgayldaleaevargglivfhn
    ghkydvpaltklaklqlnrefhlprencidtlvlsrlihsnlkdtdmgllrsgklpgale
    awgyrlgemkgeykddfkrmleeqgeeyvdgmewwnfneemmdynvqdvvvtkallekll
    sdkhyfppeidftdvgyttfwsesleavdiehraawllakqerngfpfdtkaieelyvel
    aarrsellrkltetfgswyqpkggtemfchprtgkplpkypriktpkeyvagapytpveh
    vvfnpssrdhiqkklqeagwvptkytdkgapvvddevlegvrvddpekqaaidlikeylm
    iqkrigqsaegdkawlryvaedgkihgsvnpngavtgrathafpnlaqipgvrspygeqc
    raafgaehhldgitgkpwvqagidasglelrclahfmarfdngeyaheilngdihtknqi
    aaelptrdnaktfiygflygagdekigqivgagkergkelkkkflentpaiaalresiqq
    tlvekwkrrwikgldgrkvhvrsphaalntllqsagalicklwiikteemlvekglkhgw
    dgdfaymawvhdeiqvgcrteeiaqvvietaqeamrwvgdhwnfrclldtegkmgpnwai
    ch
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t7pB (B:)
    sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t7pB (B:)
    kiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklnidq
    npgtapkygirgiptlllfkngevaatkvgalskgqlkefldanl
    

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.