PDB entry 1t7e

View 1t7e on RCSB PDB site
Description: Crystal structure of mutant Pro9Ser of scorpion alpha-like neurotoxin BmK M1 from Buthus martensii Karsch
Class: toxin
Keywords: BmK M1 mutant, Scorpion toxin, Buthus martensii Karsch
Deposited on 2004-05-09, released 2004-09-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.195
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Alpha-like neurotoxin BmK-I
  Species: Mesobuthus martensii [TaxId:34649]
  Gene: BmK M1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P45697 (2-65)
    • cloning artifact (0-1)
    • engineered (10)
  Domains in SCOPe 2.08: d1t7ea1, d1t7ea2
• Heterogens: PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1t7eA (A:)
  nsvrdayiakshncvyecarneycndlctkngaksgycqwvgkygngcwcielpdnvpir
  vpgkch