PDB entry 1t6j

View 1t6j on RCSB PDB site
Description: Crystal Structure of Phenylalanine Ammonia Lyase from Rhodosporidium toruloides
Class: lyase
Keywords: triple helix coiled coil; MIO; cinnamate, LYASE
Deposited on 2004-05-06, released 2004-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phenylalanine ammonia-lyase
    Species: Rhodosporidium toruloides [TaxId:5286]
    Gene: PAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11544 (Start-715)
      • modified residue (50)
      • modified residue (168)
      • see remark 999 (210)
      • modified residue (249)
      • modified residue (277)
      • modified residue (287)
      • modified residue (298)
      • modified residue (303)
      • modified residue (421)
      • modified residue (442)
      • modified residue (447)
      • modified residue (496)
      • modified residue (563)
      • modified residue (713)
    Domains in SCOPe 2.07: d1t6ja_
  • Chain 'B':
    Compound: phenylalanine ammonia-lyase
    Species: Rhodosporidium toruloides [TaxId:5286]
    Gene: PAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11544 (Start-715)
      • modified residue (50)
      • modified residue (168)
      • see remark 999 (210)
      • modified residue (249)
      • modified residue (277)
      • modified residue (287)
      • modified residue (298)
      • modified residue (303)
      • modified residue (421)
      • modified residue (442)
      • modified residue (447)
      • modified residue (496)
      • modified residue (563)
      • modified residue (713)
    Domains in SCOPe 2.07: d1t6jb_
  • Heterogens: CIN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t6jA (A:)
    mapsldsishsfangvasakqavngastnlavagshlpttqvtqvdivekmlaaptdstl
    eldgyslnlgdvvsaarkgrpvrvkdsdeirskidksveflrsqlsmsvygvttgfggsa
    dtrtedaislqkallehqlcgvlpssfdsfrlgrglenslplevvrgamtirvnsltrgh
    savrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaaisghpdskvhvvhegk
    ekilyareamalfnlepvvlgpkeglglvngtavsasmatlalhdahmlsllsqsltamt
    veamvghagsfhpflhdvtrphptqievagnirkllegsrfavhheeevkvkddegilrq
    dryplrtspqwlgplvsdlihahavltieagqsttdnplidvenktshhggnfqaaavan
    tmektrlglaqigklnftqltemlnagmnrglpsclaaedpslsyhckgldiaaaaytse
    lghlanpvtthvqpaemanqavnslalisarrttesndvlslllathlycvlqaidlrai
    efefkkqfgpaivslidqhfgsamtgsnlrdelvekvnktlakrleqtnsydlvprwhda
    fsfaagtvvevlsstslslaavnawkvaaaesaisltrqvretfwsaastsspalsylsp
    rtqilyafvreelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnvllkmla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6jA (A:)
    ttqvtqvdivekmlaaptdstleldgyslnlgdvvsaarkgrpvrvkdsdeirskidksv
    eflrsqtedaislqkallehqlcgvlpssfdsfrlgrglenslplevvrgamtirvnslt
    rghsavrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaaisghpdskvhvvh
    egkekilyareamalfnlepvvlgpkeglglvngtavsasmatlalhdahmlsllsqslt
    amtveamvghagsfhpflhdvtrphptqievagnirkllegsrfavhheeerqdryplrt
    spqwlgplvsdlihahavltieagqsttdnplidvenktshhggnfqaaavantmektrl
    glaqigklnftqltemlnagmnrglpsclaaedpslsyhckgldiaaaaytselghlanp
    vtthvqpaemanqavnslalisarrttesndvlslllathlycvlqaidlraiefefkkq
    fgpaivslidqhfgsamtgsnlrdelvekvnktlakrleqtnsydlvprwhdafsfaagt
    vvevlsstslslaavnawkvaaaesaisltrqvretfwsaastsspalsylsprtqilya
    fvreelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnvllkmla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t6jB (B:)
    mapsldsishsfangvasakqavngastnlavagshlpttqvtqvdivekmlaaptdstl
    eldgyslnlgdvvsaarkgrpvrvkdsdeirskidksveflrsqlsmsvygvttgfggsa
    dtrtedaislqkallehqlcgvlpssfdsfrlgrglenslplevvrgamtirvnsltrgh
    savrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaaisghpdskvhvvhegk
    ekilyareamalfnlepvvlgpkeglglvngtavsasmatlalhdahmlsllsqsltamt
    veamvghagsfhpflhdvtrphptqievagnirkllegsrfavhheeevkvkddegilrq
    dryplrtspqwlgplvsdlihahavltieagqsttdnplidvenktshhggnfqaaavan
    tmektrlglaqigklnftqltemlnagmnrglpsclaaedpslsyhckgldiaaaaytse
    lghlanpvtthvqpaemanqavnslalisarrttesndvlslllathlycvlqaidlrai
    efefkkqfgpaivslidqhfgsamtgsnlrdelvekvnktlakrleqtnsydlvprwhda
    fsfaagtvvevlsstslslaavnawkvaaaesaisltrqvretfwsaastsspalsylsp
    rtqilyafvreelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnvllkmla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t6jB (B:)
    ttqvtqvdivekmlaaptdstleldgyslnlgdvvsaarkgrpvrvkdsdeirskidksv
    eflrsqtedaislqkallehqlcgvlpssfdsfrlgrglenslplevvrgamtirvnslt
    rghsavrlvvlealtnflnhgitpivplrgtisasgdlsplsyiaaaisghpdskvhvvh
    egkekilyareamalfnlepvvlgpkeglglvngtavsasmatlalhdahmlsllsqslt
    amtveamvghagsfhpflhdvtrphptqievagnirkllegsrfavhheeerqdryplrt
    spqwlgplvsdlihahavltieagqsttdnplidvenktshhggnfqaaavantmektrl
    glaqigklnftqltemlnagmnrglpsclaaedpslsyhckgldiaaaaytselghlanp
    vtthvqpaemanqavnslalisarrttesndvlslllathlycvlqaidlraiefefkkq
    fgpaivslidqhfgsamtgsnlrdelvekvnktlakrleqtnsydlvprwhdafsfaagt
    vvevlsstslslaavnawkvaaaesaisltrqvretfwsaastsspalsylsprtqilya
    fvreelgvkarrgdvflgkqevtigsnvskiyeaiksgrinnvllkmla