PDB entry 1t66

View 1t66 on RCSB PDB site
Description: The structure of FAB with intermediate affinity for fluorescein.
Deposited on 2004-05-05, released 2004-05-18
The last revision prior to the SCOP 1.71 freeze date was dated 2004-06-15, with a file datestamp of 2004-06-15.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.204
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t66C (C:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqnskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t66D (D:)
    evkldetggglvqpgrpmklscvasgftfsdywmnwvrqspekglewvaqirnkpynyet
    yysdsvkgrftisrddskssvylqmnnlraedmgiyyctsygyhgaywgqgtlvtvsaak
    ttapsvyplapgtaalkssmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsaly
    tltssvtvpssswpsqtvtcnvahpasstkvdkkivprnc
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t66H (H:)
    evkldetggglvqpgrpmklscvasgftfsdywmnwvrqspekglewvaqirnkpynyet
    yysdsvkgrftisrddskssvylqmnnlraedmgiyyctsygyhgaywgqgtlvtvsaak
    ttapsvyplapgtaalkssmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsaly
    tltssvtvpssswpsqtvtcnvahpasstkvdkkivprnc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t66L (L:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpwtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqnskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec