PDB entry 1t3v

View 1t3v on RCSB PDB site
Description: The NMR solution structure of TM1816
Class: Structural Genomics, UNKNOWN FUNCTION
Keywords: alpha-beta, Structural Genomics, Protein Structure Initiative, PSI, Joint Center for Structural Genomics, JCSG, UNKNOWN FUNCTION
Deposited on 2004-04-27, released 2004-12-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM1816
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1t3va_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1t3vA (A:)
miiaipvsenrgkdspisehfgrapyfafvkvknnaiadisveenplaqdhvhgavpnfv
kekgaelvivrgigrraiaafeamgvkvikgasgtveevvnqylsgqlkdsdyevhdhhh
hehh