PDB entry 1t3c

View 1t3c on RCSB PDB site
Description: Clostridium botulinum type E catalytic domain E212Q mutant
Class: hydrolase, toxin
Keywords: Clostridium botulinum, catalytic domain, E212Q mutant, light chain, HYDROLASE, TOXIN
Deposited on 2004-04-26, released 2004-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.245
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neurotoxin type E
    Species: Clostridium botulinum [TaxId:1491]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00496 (0-End)
      • engineered (211)
    Domains in SCOPe 2.07: d1t3ca_
  • Chain 'B':
    Compound: neurotoxin type E
    Species: Clostridium botulinum [TaxId:1491]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00496 (0-End)
      • engineered (211)
    Domains in SCOPe 2.07: d1t3cb_
  • Heterogens: ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t3cA (A:)
    pkinsfnyndpvndrtilyikpggcqefyksfnimkniwiipernvigttpqdfhpptsl
    kngdssyydpnylqsdeekdrflkivtkifnrinnnlsggilleelskanpylgndntpd
    nqfhigdasaveikfsngsqdillpnviimgaepdlfetnssnislrnnympsnhgfgsi
    aivtfspeysfrfndnsmnefiqdpaltlmhqlihslhglygakgittkytitqkqnpli
    tnirgtnieefltfggtdlniitsaqsndiytnlladykkiasklskvqvsnpllnpykd
    vfeakygldkdasgiysvninkfndifkklysftefdlatkfqvkcrqtyigqykyfkls
    nllndsiynisegyninnlkvnfrgqnanlnpriitpitgrglvkkiirfcknivsvkgi
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t3cA (A:)
    pkinsfnyndpvndrtilyikpggcqefyksfnimkniwiipernvigttpqdfhpptsl
    kngdssyydpnylqsdeekdrflkivtkifnrinnnlsggilleelskanpylgndntpd
    nqfhigdasaveikfsngsqdillpnviimgaepdlfetnssnislrnnympsnhgfgsi
    aivtfspeysfrfndnsmnefiqdpaltlmhqlihslhglygakgittkytitqkqnpli
    tnirgtnieefltfggtdlniitsaqsndiytnlladykkiasklskvqvsnpllnpykd
    vfeakygldkdasgiysvninkfndifkklysftefdlatkfqvkcrqtyigqykyfkls
    nllndsiynisegyninnlkvnfrgqnanlnpriitpitgrglvkkiirfc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t3cB (B:)
    pkinsfnyndpvndrtilyikpggcqefyksfnimkniwiipernvigttpqdfhpptsl
    kngdssyydpnylqsdeekdrflkivtkifnrinnnlsggilleelskanpylgndntpd
    nqfhigdasaveikfsngsqdillpnviimgaepdlfetnssnislrnnympsnhgfgsi
    aivtfspeysfrfndnsmnefiqdpaltlmhqlihslhglygakgittkytitqkqnpli
    tnirgtnieefltfggtdlniitsaqsndiytnlladykkiasklskvqvsnpllnpykd
    vfeakygldkdasgiysvninkfndifkklysftefdlatkfqvkcrqtyigqykyfkls
    nllndsiynisegyninnlkvnfrgqnanlnpriitpitgrglvkkiirfcknivsvkgi
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t3cB (B:)
    pkinsfnyndpvndrtilyikpggcqefyksfnimkniwiipernvigttpqdfhpptsl
    kngdssyydpnylqsdeekdrflkivtkifnrinnnlsggilleelskanpylgndntpd
    nqfhigdasaveikfsngsqdillpnviimgaepdlfetnssnislrnnympsnhgfgsi
    aivtfspeysfrfndnsmnefiqdpaltlmhqlihslhglygakgittkytitqkqnpli
    tnirgtnieefltfggtdlniitsaqsndiytnlladykkiasklskvqvsnpllnpykd
    vfeakygldkdasgiysvninkfndifkklysftefdlatkfqvkcrqtyigqykyfkls
    nllndsiynisegyninnlkvnfrgqnanlnpriitpitgrglvkkiir