PDB entry 1t2j

View 1t2j on RCSB PDB site
Description: Crystal structure of a Human VH domain
Class: immune system
Keywords: beta-sandwich, Immunoglobulin fold, IMMUNE SYSTEM
Deposited on 2004-04-21, released 2005-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.16
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: M12-Variable Heavy domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t2ja1, d1t2ja2
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t2jA (A:)
    qvqlqesggglvqpggslrlscaasgftfsnsamswvrqapgkglewvssisgsggntys
    adsvkgrftisrdnaknslylqmnslraedtavyycardwygmdvwgqgttvtvss