PDB entry 1t2f

View 1t2f on RCSB PDB site
Description: Human B lactate dehydrogenase complexed with NAD+ and 4-hydroxy-1,2,5-oxadiazole-3-carboxylic acid
Class: oxidoreductase
Keywords: Protein-ligand complex, OXIDOREDUCTASE
Deposited on 2004-04-21, released 2004-05-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.221
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-lactate dehydrogenase B chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07195 (0-End)
      • engineered (331)
    Domains in SCOPe 2.06: d1t2fa1, d1t2fa2
  • Chain 'B':
    Compound: L-lactate dehydrogenase B chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07195 (0-End)
      • engineered (331)
    Domains in SCOPe 2.06: d1t2fb1, d1t2fb2
  • Chain 'C':
    Compound: L-lactate dehydrogenase B chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07195 (0-End)
      • engineered (331)
    Domains in SCOPe 2.06: d1t2fc1, d1t2fc2
  • Chain 'D':
    Compound: L-lactate dehydrogenase B chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07195 (0-End)
      • engineered (331)
    Domains in SCOPe 2.06: d1t2fd1, d1t2fd2
  • Heterogens: NAD, OXQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t2fA (A:)
    atlkekliapvaeeeatvpnnkitvvgvgqvgmacaisilgksladelalvdvledklkg
    emmdlqhgslflqtpkivadkdysvtanskivvvtagvrqqegesrlnlvqrnvnvfkfi
    ipqivkyspdciiivvsnpvdiltyvtwklsglpkhrvigsgcnldsarfrylmaeklgi
    hpsschgwilgehgdssvavwsgvnvagvslqelnpemgtdndsenwkevhkmvvesaye
    viklkgytnwaiglsvadliesmlknlsrihpvstmvkgmygienevflslpcilnargl
    tsvinqklkddevaqlkksadtlwdiqkdlkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t2fA (A:)
    atlkekliapvaeeeatvpnnkitvvgvgqvgmacaisilgksladelalvdvledklkg
    emmdlqhgslflqtpkivadkdysvtanskivvvtagvrqqegesrlnlvqrnvnvfkfi
    ipqivkyspdciiivvsnpvdiltyvtwklsglpkhrvigsgcnldsarfrylmaeklgi
    hpsschgwilgehgdssvavwsgvnvagvslqelnpemgtdndsenwkevhkmvvesaye
    viklkgytnwaiglsvadliesmlknlsrihpvstmvkgmygienevflslpcilnargl
    tsvinqklkddevaqlkksadtlwdiqkdlkf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t2fB (B:)
    atlkekliapvaeeeatvpnnkitvvgvgqvgmacaisilgksladelalvdvledklkg
    emmdlqhgslflqtpkivadkdysvtanskivvvtagvrqqegesrlnlvqrnvnvfkfi
    ipqivkyspdciiivvsnpvdiltyvtwklsglpkhrvigsgcnldsarfrylmaeklgi
    hpsschgwilgehgdssvavwsgvnvagvslqelnpemgtdndsenwkevhkmvvesaye
    viklkgytnwaiglsvadliesmlknlsrihpvstmvkgmygienevflslpcilnargl
    tsvinqklkddevaqlkksadtlwdiqkdlkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t2fB (B:)
    atlkekliapvaeeeatvpnnkitvvgvgqvgmacaisilgksladelalvdvledklkg
    emmdlqhgslflqtpkivadkdysvtanskivvvtagvrqqegesrlnlvqrnvnvfkfi
    ipqivkyspdciiivvsnpvdiltyvtwklsglpkhrvigsgcnldsarfrylmaeklgi
    hpsschgwilgehgdssvavwsgvnvagvslqelnpemgtdndsenwkevhkmvvesaye
    viklkgytnwaiglsvadliesmlknlsrihpvstmvkgmygienevflslpcilnargl
    tsvinqklkddevaqlkksadtlwdiqkdlkf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t2fC (C:)
    atlkekliapvaeeeatvpnnkitvvgvgqvgmacaisilgksladelalvdvledklkg
    emmdlqhgslflqtpkivadkdysvtanskivvvtagvrqqegesrlnlvqrnvnvfkfi
    ipqivkyspdciiivvsnpvdiltyvtwklsglpkhrvigsgcnldsarfrylmaeklgi
    hpsschgwilgehgdssvavwsgvnvagvslqelnpemgtdndsenwkevhkmvvesaye
    viklkgytnwaiglsvadliesmlknlsrihpvstmvkgmygienevflslpcilnargl
    tsvinqklkddevaqlkksadtlwdiqkdlkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t2fC (C:)
    atlkekliapvaeeeatvpnnkitvvgvgqvgmacaisilgksladelalvdvledklkg
    emmdlqhgslflqtpkivadkdysvtanskivvvtagvrqqegesrlnlvqrnvnvfkfi
    ipqivkyspdciiivvsnpvdiltyvtwklsglpkhrvigsgcnldsarfrylmaeklgi
    hpsschgwilgehgdssvavwsgvnvagvslqelnpemgtdndsenwkevhkmvvesaye
    viklkgytnwaiglsvadliesmlknlsrihpvstmvkgmygienevflslpcilnargl
    tsvinqklkddevaqlkksadtlwdiqkdlkf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1t2fD (D:)
    atlkekliapvaeeeatvpnnkitvvgvgqvgmacaisilgksladelalvdvledklkg
    emmdlqhgslflqtpkivadkdysvtanskivvvtagvrqqegesrlnlvqrnvnvfkfi
    ipqivkyspdciiivvsnpvdiltyvtwklsglpkhrvigsgcnldsarfrylmaeklgi
    hpsschgwilgehgdssvavwsgvnvagvslqelnpemgtdndsenwkevhkmvvesaye
    viklkgytnwaiglsvadliesmlknlsrihpvstmvkgmygienevflslpcilnargl
    tsvinqklkddevaqlkksadtlwdiqkdlkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t2fD (D:)
    atlkekliapvaeeeatvpnnkitvvgvgqvgmacaisilgksladelalvdvledklkg
    emmdlqhgslflqtpkivadkdysvtanskivvvtagvrqqegesrlnlvqrnvnvfkfi
    ipqivkyspdciiivvsnpvdiltyvtwklsglpkhrvigsgcnldsarfrylmaeklgi
    hpsschgwilgehgdssvavwsgvnvagvslqelnpemgtdndsenwkevhkmvvesaye
    viklkgytnwaiglsvadliesmlknlsrihpvstmvkgmygienevflslpcilnargl
    tsvinqklkddevaqlkksadtlwdiqkdlkf