PDB entry 1t2e

View 1t2e on RCSB PDB site
Description: Plasmodium falciparum lactate dehydrogenase S245A, A327P mutant complexed with NADH and oxamate
Class: oxidoreductase
Keywords: Ternary complex, OXIDOREDUCTASE
Deposited on 2004-04-21, released 2004-05-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.158
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-lactate dehydrogenase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: LDH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27743 (Start-315)
      • engineered (233)
      • engineered (313)
      • expression tag (316-317)
    Domains in SCOPe 2.06: d1t2ea1, d1t2ea2, d1t2ea3
  • Heterogens: NAI, OXM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t2eA (A:)
    mapkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnck
    vsgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpna
    fiivvtnpvdvmvqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivg
    ahgnkmvllkryitvggiplqefinnklisdaeleaifdrtvntaleivnlhaapyvapa
    aaiiemaesylkdlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseeka
    kfdeaiaetkrmkplahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t2eA (A:)
    apkakivlvgsgmiggvmatlivqknlgdvvlfdivknmphgkaldtshtnvmaysnckv
    sgsntyddlagadvvivtagftkapgksdkewnrddllplnnkimieigghikkncpnaf
    iivvtnpvdvmvqllhqhsgvpknkiiglggvldtsrlkyyisqklnvcprdvnahivga
    hgnkmvllkryitvggiplqefinnklisdaeleaifdrtvntaleivnlhaapyvapaa
    aiiemaesylkdlkkvlicstllegqyghsdifggtpvvlgangveqvielqlnseekak
    fdeaiaetkrmkplahh