PDB entry 1t1n

View 1t1n on RCSB PDB site
Description: crystal structure of carbonmonoxy hemoglobin
Class: oxygen transport
Keywords: oxygen transport, hemoglobin
Deposited on 1999-03-05, released 1999-04-29
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.192
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (hemoglobin)
    Species: Trematomus newnesi
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1t1na_
  • Chain 'B':
    Compound: protein (hemoglobin)
    Species: Trematomus newnesi
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1t1nb_
  • Heterogens: ACE, HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1t1nA (A:)
slsdkdkaavralwskigkssdaigndalsrmivvypqtkiyfshwpdvtpgspnikahg
kkvmggialavskiddlktglmelseqhayklrvdpsnfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1t1nB (B:)
vewtdkersiisdifshmdyddigpkalsrclvvypwtqryfsgfgnlynaegimsnanv
aahgikvlhgldrgmknmdniadaytdlstlhseklhvdpdnfkllsdcitivlaakmgh
aftaetqgafqkflaavvsalgkqyh