PDB entry 1t1d

View 1t1d on RCSB PDB site
Description: crystal structure of the tetramerization domain of the shaker potassium channel
Class: membrane protein
Keywords: potassium channels, tetramerization domain, x-ray structure, aplysia kv1.1, proton transport, membrane protein
Deposited on 1998-09-22, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: 0.229
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (potassium channel kv1.1)
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t1da_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t1dA (A:)
    ervvinvsglrfetqlktlnqfpdtllgnpqkrnryydplrneyffdrnrpsfdailyfy
    qsggrlrrpvnvpldvfseeikfyelgenaferyredegf