PDB entry 1t0q

View 1t0q on RCSB PDB site
Description: Structure of the Toluene/o-Xylene Monooxygenase Hydroxylase
Class: oxidoreductase
Keywords: diiron, carboxylate bridge, 4-helix bundle, channel, OXIDOREDUCTASE
Deposited on 2004-04-12, released 2004-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.199
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Toluene, o-xylene monooxygenase oxygenase subunit
    Species: Pseudomonas stutzeri [TaxId:316]
    Gene: touA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t0qa_
  • Chain 'B':
    Compound: Toluene, o-xylene monooxygenase oxygenase subunit
    Species: Pseudomonas stutzeri [TaxId:316]
    Gene: touE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t0qb_
  • Chain 'C':
    Compound: touB
    Species: Pseudomonas stutzeri [TaxId:316]
    Gene: touB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t0qc_
  • Heterogens: FE, OH, SO4, MCR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t0qA (A:)
    msmlkredwydltrttnwtpkyvtenelfpeemsgargismeawekydepykitypeyvs
    iqrekdsgaysikaalerdgfvdradpgwvstmqlhfgaialeeyaastaearmarfaka
    pgnrnmatfgmmdenrhgqiqlyfpyanvkrsrkwdwahkaihtnewaaiaarsffddmm
    mtrdsvavsimltfafetgftnmqflglaadaaeagdhtfaslissiqtdesrhaqqggp
    slkilvengkkdeaqqmvdvaiwrswklfsvltgpimdyytplesrnqsfkefmlewiva
    qferqlldlgldkpwywdqfmqdldethhgmhlgvwywrptvwwdpaagvspeerewlee
    kypgwndtwgqcwdvitdnlvngkpeltvpetlpticnmcnlpiahtpgnkwnvkdyqle
    yegrlyhfgseadrwcfqidperyknhtnlvdrflkgeiqpadlagalmymslepgvmgd
    dahdyewvkayqkktnaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0qA (A:)
    smlkredwydltrttnwtpkyvtenelfpeemsgargismeawekydepykitypeyvsi
    qrekdsgaysikaalerdgfvdradpgwvstmqlhfgaialeeyaastaearmarfakap
    gnrnmatfgmmdenrhgqiqlyfpyanvkrsrkwdwahkaihtnewaaiaarsffddmmm
    trdsvavsimltfafetgftnmqflglaadaaeagdhtfaslissiqtdesrhaqqggps
    lkilvengkkdeaqqmvdvaiwrswklfsvltgpimdyytplesrnqsfkefmlewivaq
    ferqlldlgldkpwywdqfmqdldethhgmhlgvwywrptvwwdpaagvspeerewleek
    ypgwndtwgqcwdvitdnlvngkpeltvpetlpticnmcnlpiahtpgnkwnvkdyqley
    egrlyhfgseadrwcfqidperyknhtnlvdrflkgeiqpadlagalmymslepgvmgdd
    ahdyewvkayq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t0qB (B:)
    mseqqpealkplktwshlagnrrrpseyevvstnlhyftdnperpweldsnlpmqtwykk
    ycfdsplkhddwnafrdpdqlvyrtynllqdgqesyvqglfdqlndrghdqmltrewvet
    larfytparylfhalqmgsvyihqiapastitncatyetadhlrwlthtayrtrelancy
    pdvgfgkrerdvwendpawqgfreliekaliawdwgeaftainlvtkpaveeallqqlgs
    laqsegdtllgllaqaqkrdaerhrrwssalvkmalekegnrevlqkwvakwepladkai
    eaycsalpdgenaiveaksasryvrqmmgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0qB (B:)
    alkplktwshlagnrrrpseyevvstnlhyftdnperpweldsnlpmqtwykkycfdspl
    khddwnafrdpdqlvyrtynllqdgqesyvqglfdqlndrghdqmltrewvetlarfytp
    arylfhalqmgsvyihqiapastitncatyetadhlrwlthtayrtrelancypdvgfgk
    rerdvwendpawqgfreliekaliawdwgeaftainlvtkpaveeallqqlgslaqsegd
    tllgllaqaqkrdaerhrrwssalvkmalekegnrevlqkwvakwepladkaieaycsal
    pdgenaiveaksasryvrqmmg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t0qC (C:)
    matfpimsnferdfviqlvpvdtedtmdqvaekcayhsinrrvhpqpekilrvrrhedgt
    lfprgmivsdaglrptetldiifmdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0qC (C:)
    tfpimsnferdfviqlvpvdtedtmdqvaekcayhsinrrvhpqpekilrvrrhedgtlf
    prgmivsdaglrptetldiifmd