PDB entry 1t0p

View 1t0p on RCSB PDB site
Description: Structural Basis of ICAM recognition by integrin alpahLbeta2 revealed in the complex structure of binding domains of ICAM-3 and alphaLbeta2 at 1.65 A
Class: immune system
Keywords: Rossmann Fold; IG-super family domain, IMMUNE SYSTEM
Deposited on 2004-04-12, released 2005-03-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: 0.22
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Integrin alpha-L
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20701 (1-End)
      • initiating methionine (0)
      • engineered (160)
      • engineered (167)
    Domains in SCOPe 2.04: d1t0pa_
  • Chain 'B':
    Compound: Intercellular adhesion molecule-3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1t0pA (A:)
mgnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdy
vkwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsg
nidaakdiiryiigigkhfqtkesqetlhkfaskpasefvcildtfeclkdlfte

    Sequence, based on observed residues (ATOM records): (download) 
    >1t0pA (A:)
mgnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdy
vkwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsg
nidaakdiiryiigigkhfqtkesqetlhkfaskpasefvcildtfeclkdlft

  • Chain 'B':
    No sequence available.