PDB entry 1t0f

View 1t0f on RCSB PDB site
Description: Crystal Structure of the TnsA/TnsC(504-555) complex
Class: DNA binding protein
Keywords: protein-protein complex, mixed alpha-beta, DNA BINDING PROTEIN
Deposited on 2004-04-08, released 2004-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transposon Tn7 transposition protein tnsA
    Species: Escherichia coli [TaxId:562]
    Gene: TNSA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t0fa1, d1t0fa2
  • Chain 'B':
    Compound: Transposon Tn7 transposition protein tnsA
    Species: Escherichia coli [TaxId:562]
    Gene: TNSA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t0fb1, d1t0fb2
  • Chain 'C':
    Compound: Transposon Tn7 transposition protein tnsC
    Species: Escherichia coli [TaxId:562]
    Gene: TNSC
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Transposon Tn7 transposition protein tnsC
    Species: Escherichia coli [TaxId:562]
    Gene: TNSC
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, MLA, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t0fA (A:)
    gsamakanssfsevqiarrikegrgqghgkdyipwltvqevpssgrshriyshktgrvhh
    llsdlelavflslewessvldireqfpllpsdtrqiaidsgikhpvirgvdqvmstdflv
    dckdgpfeqfaiqvkpaaalqdertleklelerrywqqkqipwfiftdkeinpvvkenie
    wlysvkteevsaellaqlsplahilqekgdeniinvckqvdiaydlelgktlseiralta
    ngfikfniyksfrankcadlcisqvvnmeelryvan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0fA (A:)
    nssfsevqiarrikegrgqghgkdyipwltvqevpssgrshriyshktgrvhhllsdlel
    avflslewessvldireqfpllpsdtrqiaidsgikhpvirgvdqvmstdflvdckdgpf
    eqfaiqvkpaaalqdertleklelerrywqqkqipwfiftdkeinpvvkeniewlysvkt
    eevsaellaqlsplahilqekgdeniinvckqvdiaydlelgktlseiraltangfikfn
    iyksfrankcadlcisqvvnmeel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t0fB (B:)
    gsamakanssfsevqiarrikegrgqghgkdyipwltvqevpssgrshriyshktgrvhh
    llsdlelavflslewessvldireqfpllpsdtrqiaidsgikhpvirgvdqvmstdflv
    dckdgpfeqfaiqvkpaaalqdertleklelerrywqqkqipwfiftdkeinpvvkenie
    wlysvkteevsaellaqlsplahilqekgdeniinvckqvdiaydlelgktlseiralta
    ngfikfniyksfrankcadlcisqvvnmeelryvan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0fB (B:)
    sfsevqiarrikegrgqghgkdyipwltvqevpssgrshriyshktgrvhhllsdlelav
    flslewessvldireqfpllpsdtrqiaidsgikhpvirgvdqvmstdflvdckdgpfeq
    faiqvkpaaalqdertleklelerrywqqkqipwfiftdkeinpvvkeniewlysvktee
    vsaellaqlsplahilqekgdeniinvckqvdiaydlelgktlseiraltangfikfniy
    ksfrankcadlcisqvvnmeel
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.