PDB entry 1szt

View 1szt on RCSB PDB site
Description: atomic structure of a thermostable subdomain of hiv-1 gp41
Deposited on 1997-07-28, released 1997-12-24
The last revision prior to the SCOP 1.65 freeze date was dated 1997-12-24, with a file datestamp of 1997-12-24.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.208
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.65: d1szt__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1szt_ (-)
  sgivqqqnnllraieaqqhllqltvwgikqlqarsggrggwmewdreinnytslihslie
  esqnqqek