PDB entry 1syt

View 1syt on RCSB PDB site
Description: Crystal structure of signalling protein from goat SPG-40 in the presense of N,N',N''-triacetyl-chitotriose at 2.6A resolution
Class: signaling protein
Keywords: signalling protein, Goat SPG-40, 2.6A resolution, SIGNALING PROTEIN
Deposited on 2004-04-02, released 2004-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.181
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bp40
    Species: Capra hircus [TaxId:9925]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAL87007 (0-360)
      • see remark 999 (32)
      • see remark 999 (130)
      • see remark 999 (204-205)
      • see remark 999 (251)
      • see remark 999 (359)
    Domains in SCOPe 2.07: d1syta1, d1syta2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sytA (A:)
    yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
    tlknrnpklktllsvggwnfgperfskiasktqsrrtfiksvppflrthgfdgldlawly
    pgrrdkrhltalvkemkaefareaqagterlllsaavsagkiaidrgydiaqisrhldfi
    slltydfhgawrqtvghhsplfrgnsdassrfsnadyavsymlrlgapanklvmgiptfg
    rsftlassktdggapisgpgipgrftkekgilayyeicdflhgatthrfrdqqvpyatkg
    nqwvayddqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlar
    v