PDB entry 1syr

View 1syr on RCSB PDB site
Description: Initial Structural Analysis of Plasmodium falciparum thioredoxin
Class: structural genomics, unknown function
Keywords: SGPP, STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, Structural Genomics of Pathogenic Protozoa Consortium, UNKNOWN FUNCTION
Deposited on 2004-04-01, released 2004-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.199
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF14_0545
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1syra_
  • Chain 'B':
    Compound: thioredoxin
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF14_0545
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1syrb_
  • Chain 'C':
    Compound: thioredoxin
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF14_0545
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1syrc_
  • Chain 'D':
    Compound: thioredoxin
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF14_0545
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1syrd_
  • Chain 'E':
    Compound: thioredoxin
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF14_0545
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1syre_
  • Chain 'F':
    Compound: thioredoxin
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF14_0545
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1syrf_
  • Chain 'G':
    Compound: thioredoxin
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF14_0545
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1syrg_
  • Chain 'H':
    Compound: thioredoxin
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF14_0545
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1syrh_
  • Chain 'I':
    Compound: thioredoxin
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF14_0545
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1syri_
  • Chain 'J':
    Compound: thioredoxin
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF14_0545
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1syrj_
  • Chain 'K':
    Compound: thioredoxin
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF14_0545
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1syrk_
  • Chain 'L':
    Compound: thioredoxin
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF14_0545
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1syrl_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1syrA (A:)
    mahhhhhhmvkivtsqaefdsiisqnelvivdffaewcgpckriapfyeecsktytkmvf
    ikvdvdevsevtekenitsmptfkvykngssvdtllgandsalkqliekyaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1syrA (A:)
    mvkivtsqaefdsiisqnelvivdffaewcgpckriapfyeecsktytkmvfikvdvdev
    sevtekenitsmptfkvykngssvdtllgandsalkqliekya
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1syrB (B:)
    mahhhhhhmvkivtsqaefdsiisqnelvivdffaewcgpckriapfyeecsktytkmvf
    ikvdvdevsevtekenitsmptfkvykngssvdtllgandsalkqliekyaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1syrB (B:)
    vkivtsqaefdsiisqnelvivdffaewcgpckriapfyeecsktytkmvfikvdvdevs
    evtekenitsmptfkvykngssvdtllgandsalkqliekya
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1syrC (C:)
    mahhhhhhmvkivtsqaefdsiisqnelvivdffaewcgpckriapfyeecsktytkmvf
    ikvdvdevsevtekenitsmptfkvykngssvdtllgandsalkqliekyaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1syrC (C:)
    mvkivtsqaefdsiisqnelvivdffaewcgpckriapfyeecsktytkmvfikvdvdev
    sevtekenitsmptfkvykngssvdtllgandsalkqliekya
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1syrD (D:)
    mahhhhhhmvkivtsqaefdsiisqnelvivdffaewcgpckriapfyeecsktytkmvf
    ikvdvdevsevtekenitsmptfkvykngssvdtllgandsalkqliekyaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1syrD (D:)
    vkivtsqaefdsiisqnelvivdffaewcgpckriapfyeecsktytkmvfikvdvdevs
    evtekenitsmptfkvykngssvdtllgandsalkqliekya
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1syrE (E:)
    mahhhhhhmvkivtsqaefdsiisqnelvivdffaewcgpckriapfyeecsktytkmvf
    ikvdvdevsevtekenitsmptfkvykngssvdtllgandsalkqliekyaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1syrE (E:)
    vkivtsqaefdsiisqnelvivdffaewcgpckriapfyeecsktytkmvfikvdvdevs
    evtekenitsmptfkvykngssvdtllgandsalkqliekya
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1syrF (F:)
    mahhhhhhmvkivtsqaefdsiisqnelvivdffaewcgpckriapfyeecsktytkmvf
    ikvdvdevsevtekenitsmptfkvykngssvdtllgandsalkqliekyaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1syrF (F:)
    vkivtsqaefdsiisqnelvivdffaewcgpckriapfyeecsktytkmvfikvdvdevs
    evtekenitsmptfkvykngssvdtllgandsalkqliekya
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1syrG (G:)
    mahhhhhhmvkivtsqaefdsiisqnelvivdffaewcgpckriapfyeecsktytkmvf
    ikvdvdevsevtekenitsmptfkvykngssvdtllgandsalkqliekyaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1syrG (G:)
    vkivtsqaefdsiisqnelvivdffaewcgpckriapfyeecsktytkmvfikvdvdevs
    evtekenitsmptfkvykngssvdtllgandsalkqliekya
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1syrH (H:)
    mahhhhhhmvkivtsqaefdsiisqnelvivdffaewcgpckriapfyeecsktytkmvf
    ikvdvdevsevtekenitsmptfkvykngssvdtllgandsalkqliekyaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1syrH (H:)
    mvkivtsqaefdsiivivdffaewcgpckriapfyeecsktytkmvfikvdvdevsevte
    kenitsmptfkvykngssvdtllgandsalkqliekya
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1syrI (I:)
    mahhhhhhmvkivtsqaefdsiisqnelvivdffaewcgpckriapfyeecsktytkmvf
    ikvdvdevsevtekenitsmptfkvykngssvdtllgandsalkqliekyaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1syrI (I:)
    vkivtsqaefdsiisqnelvivdffaewcgpckriapfyeecsktytkmvfikvdvdevs
    evtekenitsmptfkvykngssvdtllgandsalkqliekya
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1syrJ (J:)
    mahhhhhhmvkivtsqaefdsiisqnelvivdffaewcgpckriapfyeecsktytkmvf
    ikvdvdevsevtekenitsmptfkvykngssvdtllgandsalkqliekyaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1syrJ (J:)
    vkivtsqaefdsiisqnelvivdffaewcgpckriapfyeecsktytkmvfikvdvdevs
    evtekenitsmptfkvykngssvdtllgandsalkqliekya
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1syrK (K:)
    mahhhhhhmvkivtsqaefdsiisqnelvivdffaewcgpckriapfyeecsktytkmvf
    ikvdvdevsevtekenitsmptfkvykngssvdtllgandsalkqliekyaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1syrK (K:)
    vkivtsqaefdsiisqnelvivdffaewcgpckriapfyeecsktytkmvfikvdvdevs
    evtekenitsmptfkvykngssvdtllgandsalkqliekya
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1syrL (L:)
    mahhhhhhmvkivtsqaefdsiisqnelvivdffaewcgpckriapfyeecsktytkmvf
    ikvdvdevsevtekenitsmptfkvykngssvdtllgandsalkqliekyaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1syrL (L:)
    vkivtsqaefdsiisqnelvivdffaewcgpckriapfyeecsktytkmvfikvdvdevs
    evtekenitsmptfkvykngssvdtllgandsalkqliekya