PDB entry 1sxt

View 1sxt on RCSB PDB site
Description: staphylococcal enterotoxin type a (sea) co-crystallised with zinc
Class: superantigen
Keywords: superantigen, staphylococcus, enterotoxin, toxin
Deposited on 1996-11-14, released 1997-11-19
The last revision prior to the SCOP 1.73 freeze date was dated 1997-11-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.206
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: staphylococcal enterotoxin type a
    Species: STAPHYLOCOCCUS AUREUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1sxta1, d1sxta2
  • Chain 'B':
    Compound: staphylococcal enterotoxin type a
    Species: STAPHYLOCOCCUS AUREUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1sxtb1, d1sxtb2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sxtA (A:)
    sekseeinekdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftd
    hswyndllvdfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt
    eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq
    rglivfhtstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sxtA (A:)
    kdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftdhswyndllv
    dfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlteekkvpinl
    wldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvqrglivfhts
    tepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sxtB (B:)
    sekseeinekdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftd
    hswyndllvdfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt
    eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq
    rglivfhtstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sxtB (B:)
    kdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftdhswyndllv
    dfdskdivdkykgkkvdlygayygyqcanktacmyggvtlhdnnrlteekkvpinlwldg
    kqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvqrglivfhtsteps
    vnydlfgaqgqysntllriyrdnktinsenmhidiylyts