PDB entry 1sxt

View 1sxt on RCSB PDB site
Description: staphylococcal enterotoxin type a (sea) co-crystallised with zinc
Deposited on 1996-11-14, released 1997-11-19
The last revision prior to the SCOP 1.65 freeze date was dated 1997-11-19, with a file datestamp of 1997-11-19.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.206
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sxtA (A:)
    sekseeinekdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftd
    hswyndllvdfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt
    eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq
    rglivfhtstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sxtA (A:)
    kdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftdhswyndllv
    dfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlteekkvpinl
    wldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvqrglivfhts
    tepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sxtB (B:)
    sekseeinekdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftd
    hswyndllvdfdskdivdkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt
    eekkvpinlwldgkqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvq
    rglivfhtstepsvnydlfgaqgqysntllriyrdnktinsenmhidiylyts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sxtB (B:)
    kdlrkkselqgtalgnlkqiyyynekaktenkeshdqflqhtilfkgfftdhswyndllv
    dfdskdivdkykgkkvdlygayygyqcanktacmyggvtlhdnnrlteekkvpinlwldg
    kqntvpletvktnkknvtvqeldlqarrylqekynlynsdvfdgkvqrglivfhtsteps
    vnydlfgaqgqysntllriyrdnktinsenmhidiylyts