PDB entry 1sxn

View 1sxn on RCSB PDB site
Description: reduced bovine superoxide dismutase at ph 5.0
Class: oxidoreductase
Keywords: oxidoreductase,superoxide acceptor, oxidoreductase
Deposited on 1997-09-17, released 1998-03-18
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.18
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cu, zn superoxide dismutase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1sxna_
  • Chain 'B':
    Compound: cu, zn superoxide dismutase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1sxnb_
  • Heterogens: CU, ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sxnA (A:)
    atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
    hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
    pddlgrggneestktgnagsrlacgvigiak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sxnB (B:)
    atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
    hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
    pddlgrggneestktgnagsrlacgvigiak