PDB entry 1sxl

View 1sxl on RCSB PDB site
Description: resonance assignments and solution structure of the second RNA-binding domain of sex-lethal determined by multidimensional heteronuclear magnetic resonance spectroscopy
Class: RNA-binding protein
Keywords: RNA-binding protein
Deposited on 1994-07-01, released 1994-09-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sex-lethal protein protein
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: SEX-LETHAL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1sxla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sxlA (A:)
    msyarpggesikdtnlyvtnlprtitddqldtifgkygsivqknilrdkltgrprgvafv
    rynkreeaqeaisalnnvipeggsqplsvrlaeehgk