PDB entry 1sxl

View 1sxl on RCSB PDB site
Description: resonance assignments and solution structure of the second rna-binding domain of sex-lethal determined by multidimensional heteronuclear magnetic resonance spectroscopy
Deposited on 1994-07-01, released 1994-09-30
The last revision prior to the SCOP 1.61 freeze date was dated 1994-09-30, with a file datestamp of 1994-10-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.61: d1sxl__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sxl_ (-)
  msyarpggesikdtnlyvtnlprtitddqldtifgkygsivqknilrdkltgrprgvafv
  rynkreeaqeaisalnnvipeggsqplsvrlaeehgk