PDB entry 1swy

View 1swy on RCSB PDB site
Description: Use of a Halide Binding Site to Bypass the 1000-atom Limit to Ab initio Structure Determination
Class: hydrolase
Keywords: Rb+ binding sites, Ab initio direct methods
Deposited on 2004-03-30, released 2004-11-23
The last revision prior to the SCOP 1.75 freeze date was dated 2004-11-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.06 Å
R-factor: 0.123
AEROSPACI score: 1.12 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: lysozyme
  Species: Bacteriophage T4
  Gene: E
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00720 (0-163)
    • engineered (71)
    • engineered (95)
  Domains in SCOP 1.75: d1swya_
• Heterogens: RB, CL, BME, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1swyA (A:)
  mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
  deaeklfnqdvaaavrgilrnaklkpvydsldavrecalinmvfqmgetgvagftnslrm
  lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl