PDB entry 1sw8

View 1sw8 on RCSB PDB site
Description: Solution structure of the N-terminal domain of Human N60D calmodulin refined with paramagnetism based strategy
Class: Calcium-Binding Protein
Keywords: calcium, calmodulin, EF-hand,NMR, lanthanide, Structural Proteomics in Europe, SPINE, Structural Genomics, Calcium-Binding Protein
Deposited on 2004-03-30, released 2004-04-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: calmodulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62158 (0-78)
    • engineered (59)
  Domains in SCOPe 2.03: d1sw8a_
• Heterogens: CA

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sw8A (A:)
  adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgd
  gtidfpefltmmarkmkdt