PDB entry 1svy

View 1svy on RCSB PDB site
Description: severin domain 2, 1.75 angstrom crystal structure
Deposited on 1998-08-10, released 1999-08-10
The last revision prior to the SCOP 1.55 freeze date was dated 1999-08-10, with a file datestamp of 1999-08-09.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.1838
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1svy__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1svy_ (-)
  eykprllhisgdknakvaevplatsslnsgdcflldagltiyqfngsksspqeknkaaev
  araidaerkglpkvevfcetdsdipaefwkllggkgaiaakh