PDB entry 1svw

View 1svw on RCSB PDB site
Description: Crystal Structure of YsxC complexed with GMPPNP
Class: hydrolase
Keywords: YsxC, GTPase, GTP-binding protein, GMPPNP, GTP, HYDROLASE
Deposited on 2004-03-30, released 2004-05-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.306
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding protein YsxC
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YsxC, ENGB, BSU28190
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1svwa_
  • Chain 'B':
    Compound: GTP-binding protein YsxC
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YsxC, ENGB, BSU28190
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1svwb_
  • Heterogens: MG, GTP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1svwA (A:)
    mkvtkseivisavkpeqypegglpeialagrsnvgkssfinslinrknlartsskpgktq
    tlnfyiindelhfvdvpgygfakvsksereawgrmietyittreelkavvqivdlrhaps
    nddvqmyeflkyygipviviatkadkipkgkwdkhakvvrqtlnidpedelilfssetkk
    gkdeawgaikkminr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1svwA (A:)
    mkvseivisavkpeqypegglpeialagrsnvgkssfinslinrknlartsskpgktqtl
    nfyiindelhfvdvpgygfaksereawgrmietyittreelkavvqivdlrhapsnddvq
    myeflkyygipviviatkadkipkgkwdkhakvvrqtlnidpedelilfssetkkgkdea
    wgaikkminr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1svwB (B:)
    mkvtkseivisavkpeqypegglpeialagrsnvgkssfinslinrknlartsskpgktq
    tlnfyiindelhfvdvpgygfakvsksereawgrmietyittreelkavvqivdlrhaps
    nddvqmyeflkyygipviviatkadkipkgkwdkhakvvrqtlnidpedelilfssetkk
    gkdeawgaikkminr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1svwB (B:)
    mkvtkseivisavkpeqypegglpeialagrsnvgkssfinslinrknlartsskpgktq
    tlnfyiindelhfvdvpgygfereawgrmietyittreelkavvqivdlrhapsnddvqm
    yeflkyygipviviatkadkipkgkwdkhakvvrqtlnidpedelilfssetkkgkdeaw
    gaikkminr