PDB entry 1svr

View 1svr on RCSB PDB site
Description: structure of severin domain 2 in solution
Deposited on 1994-10-12, released 1995-02-07
The last revision prior to the SCOP 1.55 freeze date was dated 1995-02-07, with a file datestamp of 1995-02-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1svr__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1svr_ (-)
    eykprllhisgdknakvaevplatsslnsgdcflldagltiyqfngsksspqeknkaaev
    araidaerkglpkvevfcetdsdipaefwkllgg