PDB entry 1svd

View 1svd on RCSB PDB site
Description: The structure of Halothiobacillus neapolitanus RuBisCo
Class: lyase
Keywords: beta-alpha-barrel, LYASE
Deposited on 2004-03-29, released 2005-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.146
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
    Species: Halothiobacillus neapolitanus [TaxId:927]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1svda1, d1svda2
  • Chain 'M':
    Compound: ribulose bisphosphate carboxylase small chain
    Species: Halothiobacillus neapolitanus [TaxId:927]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1svdm1
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1svdA (A:)
    mavkkysagvkeyrqtywmpeytpldsdilacfkitpqpgvdreeaaaavaaesstgtwt
    tvwtdlltdmdyykgrayriedvpgddaafyafiaypidlfeegsvvnvftslvgnvfgf
    kavrglrledvrfplayvktcggpphgiqverdkmnkygrpllgctikpklglsaknygr
    avyeclrggldftkddeninsqpfmrwrdrflfvqdatetaeaqtgerkghylnvtaptp
    eemykraefakeigapiimhdyitggftantglakwcqdngvllhihramhavidrnpnh
    gihfrvltkilrlsggdhlhtgtvvgklegdrastlgwidllresfipedrsrgiffdqd
    wgsmpgvfavasggihvwhmpalvnifgddsvlqfgggtlghpwgnaagaaanrvaleac
    vearnqgrdiekegkeiltaaaqhspelkiametwkeikfefdtvdkldtqnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1svdA (A:)
    tywmpeytpldsdilacfkitpqpgvdreeaaaavaaesstgtwttvwtdlltdmdyykg
    rayriedvpgddaafyafiaypidlfeegsvvnvftslvgnvfgfkavrglrledvrfpl
    ayvktcggpphgiqverdkmnkygrpllgctikpklglsaknygravyeclrggldftkd
    deninsqpfmrwrdrflfvqdatetaeaqtgerkghylnvtaptpeemykraefakeiga
    piimhdyitggftantglakwcqdngvllhihramhavidrnpnhgihfrvltkilrlsg
    gdhlhtgtvvgklegdrastlgwidllresfipedrsrgiffdqdwgsmpgvfavasggi
    hvwhmpalvnifgddsvlqfgggtlghpwgnaagaaanrvaleacvearnqgrdiekegk
    eiltaaaqhspelkiametwkeikf
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1svdM (M:)
    maemqdykqslkyetfsylppmnaeriraqikyaiaqgwspgiehvevknsmnqywymwk
    lpffgeqnvdnvlaeieacrsaypthqvklvaydnyaqslglafvvyrgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1svdM (M:)
    emqdykqslkyetfsylppmnaeriraqikyaiaqgwspgiehvevknsmnqywymwklp
    ffgeqnvdnvlaeieacrsaypthqvklvaydnyaqslglafvvyrgn