PDB entry 1svc

View 1svc on RCSB PDB site
Description: nfkb p50 homodimer bound to dna
Deposited on 1995-11-27, released 1996-06-10
The last revision prior to the SCOP 1.63 freeze date was dated 1996-06-10, with a file datestamp of 1996-06-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.225
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1svcP (P:)
    pylqileqpkqrgfrfryvaegpshgglpgasseknkksypqvkicnyvgpakvivqlvt
    ngknihlhahslvgkhcedgictvtagpkdmvvgfanlgilhvtkkkvfetlearmteac
    irgynpgllvhpdlaylqaegggdrqlgdrekelirqaalqqtkemdlsvvrlmftaflp
    dstgsftrrlepvvsdaiydskapnasnlkivrmdrtagcvtggeeiyllcdkvqkddiq
    irfyeeeenggvwegfgdfsptdvhrqfaivfktpkykdinitkpasvfvqlrrksdlet
    sepkpflyype