PDB entry 1svb

View 1svb on RCSB PDB site
Description: envelope glycoprotein from tick-borne encephalitis virus
Deposited on 1995-11-27, released 1996-06-10
The last revision prior to the SCOP 1.55 freeze date was dated 1996-06-10, with a file datestamp of 1996-06-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.183
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1svb_ (-)
    srcthlenrdfvtgtqgttrvtlvlelggcvtitaegkpsmdvwldaiyqenpaktreyc
    lhaklsdtkvaarcptmgpatlaeehqggtvckrdqsdrgwgnhcglfgkgsivacvkaa
    ceakkkatghvydankivytvkvephtgdyvaanethsgrktasftissektiltmgeyg
    dvsllcrvasgvdlaqtvileldktvehlptawqvhrdwfndlalpwkhegaqnwnnaer
    lvefgaphavkmdvynlgdqtgvllkalagvpvahiegtkyhlksghvtcevgleklkmk
    gltytmcdktkftwkraptdsghdtvvmevtfsgtkpcripvravahgspdvnvamlitp
    nptienngggfiemqlppgdniiyvgelshqwfqk