PDB entry 1sva

View 1sva on RCSB PDB site
Description: simian virus 40
Class: Virus
Keywords: VIRUS COAT PROTEIN, Icosahedral virus
Deposited on 1995-11-27, released 1996-06-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-07.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.257
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: simian virus 40
    Species: Simian virus 40 [TaxId:10633]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sva1_
  • Chain '2':
    Compound: simian virus 40
    Species: Simian virus 40 [TaxId:10633]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sva2_
  • Chain '3':
    Compound: simian virus 40
    Species: Simian virus 40 [TaxId:10633]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sva3_
  • Chain '4':
    Compound: simian virus 40
    Species: Simian virus 40 [TaxId:10633]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sva4_
  • Chain '5':
    Compound: simian virus 40
    Species: Simian virus 40 [TaxId:10633]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sva5_
  • Chain '6':
    Compound: simian virus 40
    Species: Simian virus 40 [TaxId:10633]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sva6_

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1sva1 (1:)
    aptkrkgscpgaapkkpkepvqvpklvikggievlgvktgvdsftevecflnpqmgnpde
    hqkglskslaaekqftddspdkeqlpcysvariplpninedltcgnilmweavtvktevi
    gvtamlnlhsgtqkthengagkpiqgsnfhffavggeplelqgvlanyrtkypaqtvtpk
    natvdsqqmntdhkavldkdnaypvecwvpdpsknentryfgtytggenvppvlhitnta
    ttvlldeqgvgplckadslyvsavdicglftntsgtqqwkglpryfkitlrkrsvknpyp
    isfllsdlinrrtqrvdgqpmigmssqveevrvyedteelpgdpdmiryidefgqtttrm
    q
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sva1 (1:)
    pkkpkepvqvpklvikggievlgvktgvdsftevecflnpqmgnpdehqkglskslaaek
    qftddspdkeqlpcysvariplpninedltcgnilmweavtvktevigvtamlnlhsgtq
    kthengagkpiqgsnfhffavggeplelqgvlanyrtkypaqtvtpknatvdsqqmntdh
    kavldkdnaypvecwvpdpsknentryfgtytggenvppvlhitntattvlldeqgvgpl
    ckadslyvsavdicglftntsgtqqwkglpryfkitlrkrsvknpypisfllsdlinrrt
    qrvdgqpmigmssqveevrvyedteelpgdpdmiryidefgqtttrmq
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >1sva2 (2:)
    aptkrkgscpgaapkkpkepvqvpklvikggievlgvktgvdsftevecflnpqmgnpde
    hqkglskslaaekqftddspdkeqlpcysvariplpninedltcgnilmweavtvktevi
    gvtamlnlhsgtqkthengagkpiqgsnfhffavggeplelqgvlanyrtkypaqtvtpk
    natvdsqqmntdhkavldkdnaypvecwvpdpsknentryfgtytggenvppvlhitnta
    ttvlldeqgvgplckadslyvsavdicglftntsgtqqwkglpryfkitlrkrsvknpyp
    isfllsdlinrrtqrvdgqpmigmssqveevrvyedteelpgdpdmiryidefgqtttrm
    q
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sva2 (2:)
    pkkpkepvqvpklvikggievlgvktgvdsftevecflnpqmgnpdehqkglskslaaek
    qftddspdkeqlpcysvariplpninedltcgnilmweavtvktevigvtamlnlhsgtq
    kthengagkpiqgsnfhffavggeplelqgvlanyrtkypaqtvtpknatvdsqqmntdh
    kavldkdnaypvecwvpdpsknentryfgtytggenvppvlhitntattvlldeqgvgpl
    ckadslyvsavdicglftntsgtqqwkglpryfkitlrkrsvknpypisfllsdlinrrt
    qrvdgqpmigmssqveevrvyedteelpgdpdmiryidefgqtttrmq
    

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >1sva3 (3:)
    aptkrkgscpgaapkkpkepvqvpklvikggievlgvktgvdsftevecflnpqmgnpde
    hqkglskslaaekqftddspdkeqlpcysvariplpninedltcgnilmweavtvktevi
    gvtamlnlhsgtqkthengagkpiqgsnfhffavggeplelqgvlanyrtkypaqtvtpk
    natvdsqqmntdhkavldkdnaypvecwvpdpsknentryfgtytggenvppvlhitnta
    ttvlldeqgvgplckadslyvsavdicglftntsgtqqwkglpryfkitlrkrsvknpyp
    isfllsdlinrrtqrvdgqpmigmssqveevrvyedteelpgdpdmiryidefgqtttrm
    q
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sva3 (3:)
    pkkpkepvqvpklvikggievlgvktgvdsftevecflnpqmgnpdehqkglskslaaek
    qftddspdkeqlpcysvariplpninedltcgnilmweavtvktevigvtamlnlhsgtq
    kthengagkpiqgsnfhffavggeplelqgvlanyrtkypaqtvtpknatvdsqqmntdh
    kavldkdnaypvecwvpdpsknentryfgtytggenvppvlhitntattvlldeqgvgpl
    ckadslyvsavdicglftntsgtqqwkglpryfkitlrkrsvknpypisfllsdlinrrt
    qrvdgqpmigmssqveevrvyedteelpgdpdmiryidefgq
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >1sva4 (4:)
    aptkrkgscpgaapkkpkepvqvpklvikggievlgvktgvdsftevecflnpqmgnpde
    hqkglskslaaekqftddspdkeqlpcysvariplpninedltcgnilmweavtvktevi
    gvtamlnlhsgtqkthengagkpiqgsnfhffavggeplelqgvlanyrtkypaqtvtpk
    natvdsqqmntdhkavldkdnaypvecwvpdpsknentryfgtytggenvppvlhitnta
    ttvlldeqgvgplckadslyvsavdicglftntsgtqqwkglpryfkitlrkrsvknpyp
    isfllsdlinrrtqrvdgqpmigmssqveevrvyedteelpgdpdmiryidefgqtttrm
    q
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sva4 (4:)
    apkkpkepvqvpklvikggievlgvktgvdsftevecflnpqmgnpdehqkglskslaae
    kqftddspdkeqlpcysvariplpninedltcgnilmweavtvktevigvtamlnlhsgt
    qkthengagkpiqgsnfhffavggeplelqgvlanyrtkypaqtvtpknatvdsqqmntd
    hkavldkdnaypvecwvpdpsknentryfgtytggenvppvlhitntattvlldeqgvgp
    lckadslyvsavdicglftntsgtqqwkglpryfkitlrkrsvknpypisfllsdlinrr
    tqrvdgqpmigmssqveevrvyedteelpgd
    

  • Chain '5':
    Sequence, based on SEQRES records: (download)
    >1sva5 (5:)
    aptkrkgscpgaapkkpkepvqvpklvikggievlgvktgvdsftevecflnpqmgnpde
    hqkglskslaaekqftddspdkeqlpcysvariplpninedltcgnilmweavtvktevi
    gvtamlnlhsgtqkthengagkpiqgsnfhffavggeplelqgvlanyrtkypaqtvtpk
    natvdsqqmntdhkavldkdnaypvecwvpdpsknentryfgtytggenvppvlhitnta
    ttvlldeqgvgplckadslyvsavdicglftntsgtqqwkglpryfkitlrkrsvknpyp
    isfllsdlinrrtqrvdgqpmigmssqveevrvyedteelpgdpdmiryidefgqtttrm
    q
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sva5 (5:)
    kkpkepvqvpklvikggievlgvktgvdsftevecflnpqmgnpdehqkglskslaaekq
    ftddspdkeqlpcysvariplpninedltcgnilmweavtvktevigvtamlnlhsgtqk
    thengagkpiqgsnfhffavggeplelqgvlanyrtkypaqtvtpknatvdsqqmntdhk
    avldkdnaypvecwvpdpsknentryfgtytggenvppvlhitntattvlldeqgvgplc
    kadslyvsavdicglftntsgtqqwkglpryfkitlrkrsvknpypisfllsdlinrrtq
    rvdgqpmigmssqveevrvyedteelpgdpdmiryidefgqtttrmq
    

  • Chain '6':
    Sequence, based on SEQRES records: (download)
    >1sva6 (6:)
    aptkrkgscpgaapkkpkepvqvpklvikggievlgvktgvdsftevecflnpqmgnpde
    hqkglskslaaekqftddspdkeqlpcysvariplpninedltcgnilmweavtvktevi
    gvtamlnlhsgtqkthengagkpiqgsnfhffavggeplelqgvlanyrtkypaqtvtpk
    natvdsqqmntdhkavldkdnaypvecwvpdpsknentryfgtytggenvppvlhitnta
    ttvlldeqgvgplckadslyvsavdicglftntsgtqqwkglpryfkitlrkrsvknpyp
    isfllsdlinrrtqrvdgqpmigmssqveevrvyedteelpgdpdmiryidefgqtttrm
    q
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sva6 (6:)
    kkpkepvqvpklvikggievlgvktgvdsftevecflnpqmgnpdehqkglskslaaekq
    ftddspdkeqlpcysvariplpninedltcgnilmweavtvktevigvtamlnlhsgtqk
    thengagkpiqgsnfhffavggeplelqgvlanyrtkypaqtvtpknatvdsqqmntdhk
    avldkdnaypvecwvpdpsknentryfgtytggenvppvlhitntattvlldeqgvgplc
    kadslyvsavdicglftntsgtqqwkglpryfkitlrkrsvknpypisfllsdlinrrtq
    rvdgqpmigmssqveevrvyedteelpgdpdmiryidefgq