PDB entry 1sv8

View 1sv8 on RCSB PDB site
Description: Crystal structure of a signaling protein from buffalo(SPB-40)at 2.8 A resolution using crystals grown in the prsence of carbohydrates
Class: signaling protein
Keywords: crystal structure, signalling protein, buffalo
Deposited on 2004-03-28, released 2004-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2007-01-02, with a file datestamp of 2007-06-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.191
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: signalling protein spb
    Species: Bubalus bubalis
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB AAP42568 (0-360)
    Domains in SCOPe 2.07: d1sv8a3, d1sv8a4
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sv8A (A:)
    yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
    tlknrnpnlktllsvggwnygsqrfskiasktqsrrtfiksvppflrthgfdgldlawlw
    pgwrdkrhlttlvkemkaefvreaqagteqlllsaavtagkiaidrgydiaqisrhldfi
    slltydfhgawrqtvghhsplfrgnedassrfsnadyavsymlrlgapanklvmgiptfg
    rsytlassktdvgapisgpgipgrftkwkgilayyeicdflhgatthrfrdqqvpyatkg
    nqwvayddqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsaikdvlar
    v