PDB entry 1sul

View 1sul on RCSB PDB site
Description: Crystal Structure of the apo-YsxC
Class: hydrolase
Keywords: GTP, GTPase, GTP-binding, HYDROLASE
Deposited on 2004-03-26, released 2004-05-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.177
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding protein YsxC
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YsxC, ENGB, BSU28190
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1sula_
  • Chain 'B':
    Compound: GTP-binding protein YsxC
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YsxC, ENGB, BSU28190
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1sulb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sulA (A:)
    mkvtkseivisavkpeqypegglpeialagrsnvgkssfinslinrknlartsskpgktq
    tlnfyiindelhfvdvpgygfakvsksereawgrmietyittreelkavvqivdlrhaps
    nddvqmyeflkyygipviviatkadkipkgkwdkhakvvrqtlnidpedelilfssetkk
    gkdeawgaikkminr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sulA (A:)
    mkvtkseivisavkpeqypegglpeialagrsnvgkssfinslinrknlaqtlnfyiind
    elhfvdvpgygfakvsksereawgrmietyittreelkavvqivdlrhapsnddvqmyef
    lkyygipviviatkadkipkgkwdkhakvvrqtlnidpedelilfssetkkgkdeawgai
    kkminr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sulB (B:)
    mkvtkseivisavkpeqypegglpeialagrsnvgkssfinslinrknlartsskpgktq
    tlnfyiindelhfvdvpgygfakvsksereawgrmietyittreelkavvqivdlrhaps
    nddvqmyeflkyygipviviatkadkipkgkwdkhakvvrqtlnidpedelilfssetkk
    gkdeawgaikkminr