PDB entry 1suj

View 1suj on RCSB PDB site
Description: X-ray crystal structure of ambystoma tigrinum cone arrestin
Class: signaling protein
Keywords: sensory transduction, signaling protein
Deposited on 2004-03-26, released 2005-08-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.246
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cone arrestin
    Species: Ambystoma tigrinum [TaxId:8305]
    Gene: ARR2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1suja1, d1suja2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sujA (A:)
    madgskvykktcpnaklsiylgkrdfvdhvehvepvdgvvlidpeylkdrkvfvtltcaf
    rygrddldligmsfrkdlyslatqvyppetkepltplqeklmkklgahaypfcfkmgtnl
    pcsvtlqpgpddtgkscgvdfevkafcaenleekihkrnsvqlvirkvqfapanlgvapk
    teitrqfmlsdrplhleasldkeiyyhgepinvnvkinnttgkivkkikiiveqvtdvvl
    fsldkyvktvcaeetndtvaanstlsktfsvtpmlannrekrglaldgklkhedtnlast
    tvirpgmdkevlgilvsykvkvhlvvarggilgdltssdvavelpltlmhpkpsddkprs
    eediiieefarqkldgekddeeekedverees
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sujA (A:)
    skvykktcpnaklsiylgkrdfvdhvehvepvdgvvlidpeylkdrkvfvtltcafrygr
    ddldligmsfrkdlyslatqvyppetkepltplqeklmkklgahaypfcfkmgtnlpcsv
    tlqpgpddtgkscgvdfevkafcaenleekihkrnsvqlvirkvqfapanlgvapkteit
    rqfmlsdrplhleasldkeiyyhgepinvnvkinnttgkivkkikiiveqvtdvvlfsld
    kyvktvcaeetndtvaanstlsktfsvtpmlannrekrglaldgklkhedtnlasttvir
    pgmdkevlgilvsykvkvhlvvarggilgdltssdvavelpltlmhpkpsddiiieefar
    qkl