PDB entry 1ste

View 1ste on RCSB PDB site
Description: staphylococcal enterotoxin c2 from staphylococcus aureus
Deposited on 1995-08-21, released 1996-12-23
The last revision prior to the SCOP 1.63 freeze date was dated 1996-12-23, with a file datestamp of 1996-12-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.205
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ste_ (-)
    esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn
    ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg
    nhfdngnlqnvlirvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnssp
    yetgyikfienngntfwydmmpapgdkfdqskylmmyndnktvdsksvkievhlttkn