PDB entry 1ss1

View 1ss1 on RCSB PDB site
Description: staphylococcal protein a, b-domain, y15w mutant, nmr, 25 structures
Class: immune system
Keywords: immunoglobulin-binding protein, three-helical bundle, immune system
Deposited on 2004-03-23, released 2004-04-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin g binding protein a
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38507 (3-61)
      • cloning artifact (0-2)
      • engineered (16)
    Domains in SCOPe 2.03: d1ss1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ss1A (A:)
    gstadnkfnkeqqnafweilhlpnlneeqrngfiqslkddpsqsanllaeakklndaqap
    ka