PDB entry 1srx

View 1srx on RCSB PDB site
Description: three-dimensional structure of escherichia coli thioredoxin-s2 to 2.8 angstroms resolution
Deposited on 1976-05-06, released 1976-05-19
The last revision prior to the SCOP 1.67 freeze date was dated 1993-01-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1srx__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1srx_ (-)
    sdkiihltddsfdtdlvkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
    dqnpgtapkyiergiptlllfkngevaatkvgalskgqlkefldanla