PDB entry 1srx

View 1srx on RCSB PDB site
Description: three-dimensional structure of escherichia coli thioredoxin-s2 to 2.8 angstroms resolution
Deposited on 1976-05-06, released 1976-05-19
The last revision prior to the SCOP 1.59 freeze date was dated 1993-01-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.59: d1srx__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1srx_ (-)
  sdkiihltddsfdtdlvkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
  dqnpgtapkyiergiptlllfkngevaatkvgalskgqlkefldanla