PDB entry 1srv

View 1srv on RCSB PDB site
Description: thermus thermophilus groEL (hsp60 class) fragment (apical domain) comprising residues 192-336
Class: chaperone
Keywords: chaperone, hsp60, groEL, cell division, ATP-binding, phosphorylation
Deposited on 1999-03-02, released 1999-03-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.193
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (groEL (hsp60 class))
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1srva_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1srvA (A:)
    gyqfdkgyispyfvtnpetmeavledafilivekkvsnvrellpileqvaqtgkplliia
    edvegealatlvvnklrgtlsvaavkapgfgdrrkemlkdiaavtggtviseelgfklen
    atlsmlgraervritkdettivggk