PDB entry 1srm

View 1srm on RCSB PDB site
Description: 1h and 15n assignments and secondary structure of the src sh3 domain
Deposited on 1994-03-07, released 1994-05-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-05-31, with a file datestamp of 1994-06-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1srm__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1srm_ (-)
    tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps