PDB entry 1srm

View 1srm on RCSB PDB site
Description: 1h and 15n assignments and secondary structure of the src sh3 domain
Class: phosphotransferase
Keywords: phosphotransferase
Deposited on 1994-03-07, released 1994-05-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: src tyrosine kinase sh3 domain
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1srma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1srmA (A:)
    galaggvttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsny
    vaps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1srmA (A:)
    tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps