PDB entry 1srd

View 1srd on RCSB PDB site
Description: Three-dimensional structure of CU,ZN-superoxide dismutase from spinach at 2.0 Angstroms resolution
Class: oxidoreductase
Keywords: superoxide acceptor, oxidoreductase
Deposited on 1993-04-15, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-22, with a file datestamp of 2014-10-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.249
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper,Zinc Superoxide Dismutase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1srda_
  • Chain 'B':
    Compound: Copper,Zinc Superoxide Dismutase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1srdb_
  • Chain 'C':
    Compound: Copper,Zinc Superoxide Dismutase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1srdc_
  • Chain 'D':
    Compound: Copper,Zinc Superoxide Dismutase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1srdd_
  • Heterogens: CU, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1srdA (A:)
    atkkavavlkgtsnvegvvtltqeddgpttvnvrisglapgkhgfhlhefgdttngcmst
    gphfnpdkkthgapedevrhagdlgnivantdgvaeativdnqipltgpnsvvgralvvh
    eleddlgkgghelspttgnaggrlacgvvgltpv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1srdB (B:)
    atkkavavlkgtsnvegvvtltqeddgpttvnvrisglapgkhgfhlhefgdttngcmst
    gphfnpdkkthgapedevrhagdlgnivantdgvaeativdnqipltgpnsvvgralvvh
    eleddlgkgghelspttgnaggrlacgvvgltpv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1srdC (C:)
    atkkavavlkgtsnvegvvtltqeddgpttvnvrisglapgkhgfhlhefgdttngcmst
    gphfnpdkkthgapedevrhagdlgnivantdgvaeativdnqipltgpnsvvgralvvh
    eleddlgkgghelspttgnaggrlacgvvgltpv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1srdD (D:)
    atkkavavlkgtsnvegvvtltqeddgpttvnvrisglapgkhgfhlhefgdttngcmst
    gphfnpdkkthgapedevrhagdlgnivantdgvaeativdnqipltgpnsvvgralvvh
    eleddlgkgghelspttgnaggrlacgvvgltpv