PDB entry 1sr9

View 1sr9 on RCSB PDB site
Description: Crystal Structure of LeuA from Mycobacterium tuberculosis
Class: transferase
Keywords: TIM barrel, transferase
Deposited on 2004-03-22, released 2004-05-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.17
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-isopropylmalate synthase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96420
      • modified residue (40)
      • modified residue (89)
      • modified residue (97)
      • modified residue (104)
      • modified residue (256)
      • modified residue (269)
      • modified residue (389)
      • modified residue (403)
      • modified residue (440)
      • modified residue (479)
      • modified residue (558)
    Domains in SCOPe 2.05: d1sr9a1, d1sr9a2, d1sr9a3
  • Chain 'B':
    Compound: 2-isopropylmalate synthase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96420
      • modified residue (40)
      • modified residue (89)
      • modified residue (97)
      • modified residue (104)
      • modified residue (256)
      • modified residue (269)
      • modified residue (389)
      • modified residue (403)
      • modified residue (440)
      • modified residue (479)
      • modified residue (558)
    Domains in SCOPe 2.05: d1sr9b1, d1sr9b2, d1sr9b3
  • Heterogens: ZN, CL, KIV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sr9A (A:)
    mttsespdaytesfgahtivkpagpprvgqpswnpqrassmpvnryrpfaeevepirlrn
    rtwpdrvidraplwcavdlrdgnqalidpmsparkrrmfdllvrmgykeievgfpsasqt
    dfdfvreiieqgaipddvtiqvltqcrpeliertfqacsgapraivhfynstsilqrrvv
    franraevqaiatdgarkcveqaakypgtqwrfeyspesytgteleyakqvcdavgevia
    ptperpiifnlpatvemttpnvyadsiewmsrnlanresvilslhphndrgtavaaaelg
    faagadriegclfgngertgnvclvtlglnlfsrgvdpqidfsnideirrtveycnqlpv
    herhpyggdlvytafsgshqdainkgldamkldadaadcdvddmlwqvpylpidprdvgr
    tyeavirvnsqsgkggvayimktdhglslprrlqiefsqviqkiaegtageggevspkem
    wdafaeeylapvrplerirqhvdaadddggttsitatvkingveteisgsgngplaafvh
    aladvgfdvavldyyehamsagddaqaaayveasvtiaspaqpgeagrhasdpvtiaspa
    qpgeagrhasdpvtsktvwgvgiapsittaslravvsavnraar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sr9A (A:)
    tivkpagpprvgqpswnpqrassmpvnryrpfaeevepirlrnrtwpdrvidraplwcav
    dlrdgnqalidpmsparkrrmfdllvrmgykeievgfpsasqtdfdfvreiieqgaipdd
    vtiqvltqcrpeliertfqacsgapraivhfynstsilqrrvvfranraevqaiatdgar
    kcveqaakypgtqwrfeyspesytgteleyakqvcdavgeviaptperpiifnlpatvem
    ttpnvyadsiewmsrnlanresvilslhphndrgtavaaaelgfaagadriegclfgnge
    rtgnvclvtlglnlfsrgvdpqidfsnideirrtveycnqlpvherhpyggdlvytafsg
    shqdainkgldamkldadaadcdvddmlwqvpylpidprdvgrtyeavikggvayimktd
    hglslprrlqiefsqviqkievspkemwdafaeeylapvrplerirqhvdaadddggtts
    itatvkingveteisgsgngplaafvhaladvgfdvavldyyehamsagddaqaaayvea
    svtisktvwgvgiapsittaslravvsavnraa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sr9B (B:)
    mttsespdaytesfgahtivkpagpprvgqpswnpqrassmpvnryrpfaeevepirlrn
    rtwpdrvidraplwcavdlrdgnqalidpmsparkrrmfdllvrmgykeievgfpsasqt
    dfdfvreiieqgaipddvtiqvltqcrpeliertfqacsgapraivhfynstsilqrrvv
    franraevqaiatdgarkcveqaakypgtqwrfeyspesytgteleyakqvcdavgevia
    ptperpiifnlpatvemttpnvyadsiewmsrnlanresvilslhphndrgtavaaaelg
    faagadriegclfgngertgnvclvtlglnlfsrgvdpqidfsnideirrtveycnqlpv
    herhpyggdlvytafsgshqdainkgldamkldadaadcdvddmlwqvpylpidprdvgr
    tyeavirvnsqsgkggvayimktdhglslprrlqiefsqviqkiaegtageggevspkem
    wdafaeeylapvrplerirqhvdaadddggttsitatvkingveteisgsgngplaafvh
    aladvgfdvavldyyehamsagddaqaaayveasvtiaspaqpgeagrhasdpvtiaspa
    qpgeagrhasdpvtsktvwgvgiapsittaslravvsavnraar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sr9B (B:)
    tivkpagpprvgqpswnpqrassmpvnryrpfaeevepirlrnrtwpdrvidraplwcav
    dlrdgnqalidpmsparkrrmfdllvrmgykeievgfpsasqtdfdfvreiieqgaipdd
    vtiqvltqcrpeliertfqacsgapraivhfynstsilqrrvvfranraevqaiatdgar
    kcveqaakypgtqwrfeyspesytgteleyakqvcdavgeviaptperpiifnlpatvem
    ttpnvyadsiewmsrnlanresvilslhphndrgtavaaaelgfaagadriegclfgnge
    rtgnvclvtlglnlfsrgvdpqidfsnideirrtveycnqlpvherhpyggdlvytafsg
    shqdainkgldamkldadaadcdvddmlwqvpylpidprdvgrtyeavirvnkggvayim
    ktdhglslprrlqiefsqviqkvspkemwdafaeeylapvrplerirqhvdaadddggtt
    sitatvkingveteisgsgngplaafvhaladvgfdvavldyyehamsagddaqaaayve
    asvtiastsktvwgvgiapsittaslravvsavnraa